Teknologi, Media, dan Pembelajaran.


BAB I

PENDAHULUAN

  1. Latar Belakang

Teknologi sebenarnya telah ada sejak nenek moyang kita. Teknologi merupakan alat bantu untuk mempermudah kehidupan manusia. Nenek moyang menggunakan teknologi seperti pisau dari batu untuk berburu.

Di era saat ini, teknologi berkembang sangat pesat. Teknologi yang pada zaman nenek moyang seperti barang rongsokan kini menjadi barang canggih yang mampu membantu kehidupan manusia. Dengan adanya pembelajaran dan proses belajar mengajar, Sumber Daya Manusia akan menjadi sangat baik dan teknologi akan semakin maju. Pembelajaran akan sangat baik apabila menggunakan media pembelajaran yang baik pula.

Mediamerupakan salah satu komponen pembelajaran yang mempunyai peranan penting dalam Kegiatan Belajar Mengajar. Media digunakan agar pembelajaran dapat efektif dan menyenangkan. Proses belajar akan lebih baik lagi apabila mengetahui pengertian dasar mengenai Teknologi, Media, dan Pembelajaran.

  1. Tujuan Penulisan

Tujuan dalam penulisan makalah ini adalah untuk menambah pengetahuan mengenai pengertian dan isi serta peranan dari Teknologi, Media, dan Pembelajaran.

  1. Rumusan Masalah
  1. Apa pengertian Teknologi, Media, dan Pembelajaran?

  2. Bagaimana peranan Teknologi dan Media dalam Pembelajaran?

BAB II

PEMBAHASAN

  1. Pengertian Teknologi, Media, dan Pembelajaran
  1. Teknologi

Menurut Sharon E. Smaldino dan James D. Russel (2008), teknologi berasal dari Yunani,Teckneberartikerajinandanlogiaberartiketerampilan. Teknologiadalah istilahyangberhubungandenganpenggunaan danpengetahuantentangalatdanketerampilan(Instructional Technology and Media for Learning, 4)

Menurut Wikipedia Bahasa Indonesia, definisi Teknologi adalah pengembangan dan aplikasi dari alat, mesin, material, dan proses menolong manusia menyelesaikan masalahnya. Teknologi dikenal sebelum sains dan teknik. Definisi lainnya, teknologi dilihat dari status pengetahuan kita yang sekarang dalam bagaimana menggabungnya sumberdaya untuk memproduksi produk yang diinginkan.

Teknologi menurut Djoyohadikusumo (1999, 222) yang dikutip di www.canboyz.co.cc berkaitan erat dengan sains dan perekayasaan. Jadi, teknologi mengandung dua dimensi yang saling berkaitan satu sama lain. Sains mengacu pada pemahaman kita tentang dunia nyata sekitar kita, artinya mengenai ciri-ciri dasar pada dimensi ruang, tentang materi dan energi mengenai interaksinya satu sama lainnya.

(http://www.canboyz.co.cc/2010/05/pengertian-definisi-media.htm)

Teknologi berasal dari istilah teckne yang berarti seni (art) atau keterampilan. Menurut Dictionary of Science, teknologi adalah pengetahuan teoritis pada masalah praktis.

Jadi, pemahaman tentang Teknologi tidak dapat dipisahnya dari Ilmu Pengetahuan Alam dan rekayasa. Ilmu pengetahuan akan memperoleh ilmu rekayasa, sedangkan teknologi adalah hasil proses rekayasa

  1. Media

Dalam Buku Instructional Technology and Media for Learning (Sharon E. Smaldino dan James D. Russel, 6) Media merupakan bentuk jamak dari medium yang artinya sarana komunikasi. istilah ini mengacupadasesuatuyangmembawainformasiantarasumberdanpenerima. Enamkategoridasarmediaadalahteks, audio, visual, video, manipulatif(objek), danorang-orang (teknisi). Tujuanmediaadalah untukmemfasilitasikomunikasidanbelajar.

Istilah media berasal dari bahasa latin yang merupakan bentuk kedua dari medium. Secara harfiah berarti perantara atau pengantar. Pengertian umumnya adalah segala sesuatu yang dapat menyalurkan informasi dari sumber informasi kepada penerima informasi.
Media menurut AECT adalah segala sesuatu yang digunakan orang untuk menyalurkan pesan. Sedangkan
Gagne mengartikan media sebagai jenis komponen dalam lingkungan siswa yang dapat merangsang mereka untuk belajar. Briggs mengartikan media sebagai alat untuk memberikan perangsang bagi siswa agar terjadi proses belajar.

(http://wiryaterulakat.blogspot.com/2009/05/desain-pesan-pembelajaran-media.html)

Dari definisi tersebut dapat disimpulkan bahwa media adalah sarana penyalur pesan agar dapat dirangsang oleh otak, perasaan dan kemauan kita.

  1. Pembelajaran

Menurut Undang-Undang Sistem Pendidikan Nasional No. 20 Tahun 2003, Bab I Pasal 1 ayat 20 dijelaskan bahwa Pembelajaran adalah proses interaksi peserta didik dengan pendidik dan sumber belajar pada suatu lingkungan belajar.

Knirk dan Gustafson (2005) menjelaskan bahwa Pembelajaran merupakan setiap kegiatan yang dirancang oleh guru utuk membantu seseorang mempelajari suatau kemampuan dan atau nilai yang baru dalam suatu proses yang sistematis melalui tahap rancangan, pelaksanaan dan evaluasi dalam konteks belajar mengajar.

Dimayanti dan Mujiono (2005) menjabarkan bahwa pembelajaran adalah kegiatan guru secara terprogram dalam desain instruksional, untuk membuat siswa belajar secara aktif yang menekankan pada sumber belajar.

Dari beberapa pengetian pembelajaran bahwa dapat disimpulkan mengenai Pembelajaran, bahwa Pembelajaran adalah proses intraksi peserta didik dengan pendidik dan sumber belajar dalam suatu lingkungan belajar. Pembelajaran merupakan bantuan yang diberikan pendidik agar dapat terjadi proses prolehan ilmu dan pengetahuan, penguasaan kemahiran dan tabiaat, serta pembentukan sikap dan kepercayaan kepada peserta didik. Dengan kata lain Pembelajaran adalah proses untuk membantu pserta didik agar dapat belajar dengan baik.

  1. Peranan Teknologi dan Media dalam Pembelajaran

Teknologidan mediamempunyai peranan dalam belajar. Ketikainstruksiyang terpusat adalah guru, teknologidanmediadigunakan untukmendukungpenyajianinstruksi. Disisilain, ketikainstruksiyang terpusat adalah siswa, mereka merupakanpenggunautamateknologidanmedia.

Penggunaan umum teknologi dan media adalah untuk dukungan tambahan selama instruksi berpusat pada guru. Misalnya, guru dapat menggunakan papan tulis elektronik untuk menampilkan variasi dari grafik batang. Gurujuga dapatmenggunakandiagramuntuk menunjukkan bagaimanaartidarisebuahperubahankalimat. Bahanajaryang dirancang dengan baikdapatmeningkatkankegiatan belajar seorang siswa. Karakteristik peserta didik juga harus dimengerti untuk mencapai tujuan pendidikan yang diinginkan. Pemilihan strategi yang tepat, teknologi, media, dan pembelajaran akan benar-benar mampu meningkatkan pembelajaran. Dengan begitu, siswa akan mampu memberikan umpan balik.

Salah satu peran paling penting dari teknologi dan media adalah untuk melayani perubahan lingkungan pembelajaran. Unit-unitmenyediakanlingkunganyang fokusdimanapembelajaran berlangsung. Temayang baikharusmenangkapdan mempertahankan perhatiansiswa, memberikanpengalamanpemecahan masalah, dukungan kegiatankedisiplinan, danmencakupberbagaiteknologidan media.

Teknologi adalah penerapan sains dan peralatan-peralatan yang dibuat manusia untuk kemudahan hidupnya, sedangkan media merupakan alat bantu menyampaikan isi pesan yang akan disampaikan ke penerima pesan.

Teknologi instruksional biasanya dilihat dari perspektif guru. Ketika guru menggunakan komputer, pendidikan jarak jauh, internet, dll, alat-alat ini disebut dengan teknologi instruksional. Kenyataannya, komputer dan teknologi lainnya tidak membuat guru lebih mampu dalam proses mengajar. Guru harus berpengalaman saat praktek di kelas. Berbagai macam pelajaran seperti Bahasa Inggris mungkin akan membutuhkan perangkat lunak (software) untuk menulis cerita dengan beberapa akhir yang dapat memberikan banyak kesimpulan.Sementarabelajar sejarah, siswadapatmendapatkan informasi dengan sumber-sumber lain seperti di buku, surat kabar, dll. Dengan teknologi dan medianya, siswa dapat belajar seperti yang sejarawan lakukan, tidak hanya sekedar menghafal nama dan tanggal.
Siswatidaklagiterbataspadaruangkelas. Melaluimediadanjaringankomputer sepertiinternet, siswa akan lebih senang belajar.

Menurut Sharon E. Smaldino dan James D. Russel (Instructional Technology and Media Pembelajaran, 9) terdapat enam kategori dasar Media yang digunakan dalam belajar, yaitu:

  1. Teks

Media yang paling umum digunakan adalah teks. Teksalfanumerikyangdapatditampilkandalamformatbuku, poster, papan tulis, layarkomputer, dan sebagainya.

  1. Audio

Medialain yang umumdigunakandalampembelajaranadalahaudio. Audiomencakupapapunyang siswadengar,suaraseseorang, musik, suaramekanik(menjalankan mesinmobil), kebisingan, dan sebagainya.

  1. Visual

Secara teraturdigunakanuntuk meningkatkan pembelajaran. Contoh:diagramdiposter, gambarpadapapan tulis , foto, gambardi sebuahbuku, kartun, dan sebagainya.

  1. Video

Video merupakan adalahmediayangmenampilkangerak, termasuk isiDVD, video, animasikomputer, dansebagainya. Bahanseringtidakdianggapmediabendanyatadanmodel.

  1. Manipulatip

Merupakan benda yang dapat dimanipulasi, disentuh dan dikreasikan oleh siswa.

  1. Orang (Teknisi)

Teknisi yang dimaksud adalah guru, siswa, atauahlisubjek-materi. Siswabelajardariguru, siswa lain, danorang dewasa.

Proses belajar mengajar pada hakikatnya adalah proses komunikasi, yaitu proses penyampaian pesan dari sumber pesan melalui media tertentu ke penerima pesan. Pesan, sumber pesan, media dan penerima pesan merupakan komponen-komponen proses komunikasi.

Guru sangat bertanggung jawab dalam proses pembelajaran di kelas. Oleh karena itu, perlu diketahui mengenai Tipe Belajar seorang siswa.

  1. DomainKognitif

Meliputi: Pengetahuan, pemahaman, aplikasi, sintesis, evaluasi. Dalamdomainkognitif, belajarmelibatkanberbagaikemampuanintelektualyangdapat diklasifikasikanbaiksebagaiverbal/informasivisualatausebagaiketerampilanintelektual. Belajarvisualbiasanyamenghafalataumengingatfaktaatauinformasi. Siswa akan menghasilkanide-ideyang berkaitanbentukobjekdengan fungsinya.

  1. DomainAfektif

Meliputi: pengenalan, merespon, penghargaan, pengorganisasian, pengamalan.Domainafektifmencakupsikap, perasaan, dannilai-nilai. TujuanAfektif mendorongsikapsosial yang sehat.

  1. Domain Psikomotorik

Meliputi: Peniruan, penggunaan, ketepatan, perangkaian, evaluasi.Gurudisemuatingkatankelasharusmengajarkanbeberapaketerampilanmotorikkepada siswa. Misalnya, di kelas paling kecil, guru mengajarkan menggunakan pensil yang benar, di Sekolah Dasar guru mengajarkanpenggunaankeyboardkomputer, mikroskopsederhana, dan alatukur, dandisekolahmenengahdanperguruan tinggipenggunaanperalatanilmu pengetahuan.

  1. Domain Interpersonal

Belajar dalam domain interpersonal melibatkan interaksi antara orang yang satu dengan yang lain. Dengan guru yang berperan sebagai fasilitator, siswa sangat sering ditempatkan ke dalam berbagai kegiatan belajar. Guru mengajarkan pada siswanya bagaimana untuk mendengarkan, berbagi, menghormati, membantu, dan sebagainya. Keterampilan lainnya diperlukan untuk mencapai komunikasi interpersonal afektif.

Menurut Sharon E. Smaldino dan James D. Russel (2008) di samping terdapat Tipe Belajar ada juga Pandangan Belajar secara Psikologi. Guru melihatperanteknologidanmediadikelassangat tergantungpadabagaimanaorangbelajar.

  1. Pandangan Behavioristik

Skinner, seorangpsikologdiHarvardUniversity, melakukanstudiilmiahtentang perilakuyang dapat diamati. Dia adalahseorangpendukungbehavioristik. Diatertarik padabelajarketerampilanbaru, seperti yang digambarkan olehanjingPavlov, di mana perangsangan asli dan netral dipasangkan dengan stimulus bersayarat secara berulang-ulang sehingga memunculkan reaksi yang diinginkan (Psikologi Pendidikan, 94).Berdasarkan teori belajar itu dikenal denganteoripenguatan. Serangkaian percobaan juga dilakukan padamerpati. Diaberalasanbahwaproseduryang samabisadigunakandenganmanusia. Hasilnyaadalahmunculnyainstruksi yang diprogramkanyangkemudianberkembang menjadiinstruksikomputer-assistend. Tidak sepertisebelumnyabelajarpenelitian, karyaSkinnersangatlogisdantepat, yang mengarahlangsungkeinstruksibelajar. Behavioristikmenolakuntukberspekulasimengenaiapayang terjadi ketikabelajarberlangsung. Merekahanya mengandalkanperilakuyang diamati. Sebagai hasilnya, merekalebihnyamanmenjelaskantugas-tugasbelajaryang relatifsederhana. Karenapadaposisi ini,behavioristikmemilikiaplikasiterbatasdalammengajarkan keterampilantingkat yang lebih tinggi. Behavioristikengganuntuk membuatkesimpulantentangbagaimanamengenai memproses informasi.

  1. PandanganKognitif

Belajar adalah perubahan presepsi dan pemahaman, tidak selalu berbentuk tingkah laku yang dapat diamati dan diukur.Teori ini lebih mengutamakan proses belajar daripada hasil belajarnya. Kognitifmemberikan kontribusibaruuntuk belajarteoridenganmenciptakanmodeltentang bagaimanapeserta didikmenerima, proses, danmemanipulasiinformasi. Kognitifmembuatmodelmentaldarimemorijangkapendekdan jangkapanjang. Informasi barudisimpandalammemorijangka pendek, di manaiadilatihhingga siapuntuk disimpandalammemorijangkapanjang. Jikainformasitidakberlatih, fadesdarimemorijangka pendek. Pembelajarkemudianmenggabungkaninformasidanketerampilandalammemorijangkapanjanguntukmengembangkan strategikognitif, atauketerampilanuntukmenanganitugas yangkompleks. Siswa dapat mengembangkan sumberbelajar yangtersedia.

  1. Pandangan Konstruktivistik

Konstruktivistik melibatkan siswadalampengalamanbelajar. Konstruktivistikmenekankanbahwasiswa dapatmenciptakanide mereka sendiri. Siswamenempatkanpengalamanbelajardalam pengalamanmerekasendiridantujuaninstruksitidakuntukmengajarkaninformasitetapimenciptakansituasi sehinggasiswadapatmenginterpretasikaninformasiuntukpemahamanmereka sendiri.

Dalam hal ini guru hanya membantu agar proses pengkontruksian pengetahuan oleh siswa berjalan lancar. Guru juga tidak mentransferkan pengetahuan yang dimilikinya, melainkan membantu siswa untuk membentuk pengetahuannya sendiri.

Konstrutivistik dapat membangun dan mengubah daya pikir siswa menuju kepemikiran modern dan dapat mengembangkan manusia dan mempunyai bakat yang luar biasa, memiliki kepekaan, mandiri, bertanggung jawab dan dapat mendidik dirinya maupun generasi selanjutnya serta mampu berkolaborasi memecahkan masalah pendidikan baik praktek maupun teori dan mengarahkan ke masa depan

  1. Pandangan Sosial-Psikologi

Psikologi sosial adalah perspektif lain dalam studi pengajaran pembelajaran. Sosial psikolog melihat efek dari organisasi sosial kelas pada pembelajaran.Belajar merupakan proses pembentukan makna. Belajar bukanlah proses mengumpulkan informasi, melainkan proses pengembangan pemahaman atau pemikiran dengan membuat pemahaman baru. Proses belajar terjadi pada saat terjadi ketidak seimbangan stuktur kognitif pada diri seseorang.

PenelitisepertiRobertSlavin(1990) telah mengambil posisi bahwa pembelajaran kooperatif adalah baik lebih efektif dan lebih bermanfaat daripada belajar kompetitif dan individualistis.Slavin mengembangkan seperangkat teknik pembelajaran kooperatif yang mewujudkan prinsip-prinsip kolaborasi kelompok kecil dan penghargaan berdasarkan prestasi kelompok. Teori belajar tidak harus menggunakan satu yang dianutnya tetapi menggunakan semuanya sesuai dengan situasi.

Selamasetengah abadterakhir, prinsip-prinsippembelajaranefektiftelahberevolusidariberbagaisumber.Jadi, sebelumnya harus mengumpulkan informasi yang relevan tentang pengetahuan masing-masing siswa dan tingkat keterampilannya dengan mengatur strategi.

Katastrategiberarticaramelakukan sesuatu. Strategipembelajaranadalahcara untukmelibatkanpeserta didikdalamkegiatanbelajar-mengajartertentu. Contohnyatermasukpresentasi, demonstrasi, pembelajarankooperatif, game, simulasi, pemecahan masalah, diskusi danpraktek, dantutorial.Teknologidanmediamerupakan bagian daristrategi.Setelah memilihstrategi, maka dapat memilih teknologidanmediauntukmelaksanakanstrategi. Teknologi dan Media tidak akan memfasilitasi belajar apabila tidak ada strategi belajar.

BAB III

PENUTUP

  1. Kesimpulan

Teknologi adalah penerapan sains dan peralatan-peralatan yang dibuat manusia untuk kemudahan hidupnya, sedangkan media merupakan alat bantu menyampaikan isi pesan yang akan disampaikan ke penerima pesan. Sedangkan pembelajaran adalah proses komunikasi.

Guru sangat bertanggung jawab dalam proses pembelajaran di kelas. Oleh karena itu, perlu diketahui mengenai Tipe Belajar seorang siswa dan perspektif Psikologi Belajar seorang siswa.

  1. Saran

Teknologi dan Media tidak akan memfasilitasi belajar apabila tidak ada strategi belajar. Oleh karena itu, perlu dikuasai mengenai strategi pembelajaran.

Penulisan makalah ini masih banyak kekurangan dan kesalahan baik dalam penulisan maupun proses penyusunan. Untuk itu, penulis mengharapkan saran yang mendukung untuk kepentingan bersama.

DAFTAR PUSTAKA

Artapati, Lalu Wirya. 2009. Desain Pesan Pembelajaran Media Pembelajaran, (online), (http://wiryaterulakat.blogspot.com/2009/05/desain-pesan-pembelajaran-media.html, diakses 6 Maret 2011).

Asrofudin. 2011. Pengertian dan Definisi Media, (online), (http://www.canboyz.co.cc/2010/05/pengertian-definisi-media.html, diakses 6 Maret 2011).

Budiningsih, C. Asri. 2005. Belajar dan Pembelajaran, Jakarta: Rineka Cipta.

Christian. 2010. Apa itu Teknologi, (online), (http://chrhad.multiply.com/journal/item/1/Apa_itu_teknologi, diakses 6 Maret 2011).

Damarjanti Kusuma Dewi . 2010. Definisi Pembelajaran, (online), (http://instructionaltheorycourse.blogspot.com/2009/02/1-introduction_18.html, diakses 6 Maret 2011).

Smaldino, Sharon E. 2008. Instructional Technology and Media for Learning, Columbus: Pearson Merrill Prentice Hall.

Sugihartono, dkk. 2007. Psikologi Pendidikan, Yogyakarta: UNY Press.

Syafira. 2007. Definisi Teknologi, (online), (http://delsajoesafira.blogspot.com/2010/05/definisi-pembelajaran.html, diakses 6 Maret 2011).

Undang-undang Republik Indonesia Nomor 20 Tahun 2003 tentang Sistem Pendidikan Nasional. 2003. Bandung: Citra Umbara.

Komentar ditutup.

%d blogger menyukai ini: